PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG016109.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YB
Protein Properties Length: 143aa    MW: 16394.3 Da    PI: 5.0721
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG016109.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB145.11.6e-45599397
        NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                 +qd++lPianv+r+mk+ lP  a++sk+ak+ +qec++efisfvtseas+kc++e+rk++ngdd++wal++lGf+dy+++   yl+kyre+e++k
  CCG016109.1  5 KQDQLLPIANVGRVMKQRLPPTARVSKEAKQRMQECATEFISFVTSEASNKCRKENRKALNGDDVCWALSSLGFDDYADTTVRYLHKYREAERAK 99
                 79******************************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.1E-464126IPR009072Histone-fold
SuperFamilySSF471131.03E-366122IPR009072Histone-fold
PfamPF008086.2E-23973IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.1E-153755No hitNo description
PRINTSPR006153.1E-155674No hitNo description
PRINTSPR006153.1E-157593No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MDDDKQDQLL PIANVGRVMK QRLPPTARVS KEAKQRMQEC ATEFISFVTS EASNKCRKEN  60
RKALNGDDVC WALSSLGFDD YADTTVRYLH KYREAERAKA DQKKATDTDK VNKDEESNDT  120
SCQAVQQQTD QIPEPTILEF RFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B3e-36694492Transcription factor HapC (Eurofung)
4g91_B3e-36694492Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011023652.11e-104PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO040272e-49NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLB9I7Q21e-101B9I7Q2_POPTR; Uncharacterized protein
STRINGPOPTR_0013s02020.11e-100(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.17e-49nuclear factor Y, subunit B4